DPCstruct | MC14208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 298 ± 21 aa |
| Standard deviation of domain lengths | 20.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8QTW6 | 2-288 | DQFSRHANPFTKLRALNDLRRLVIASLTIGNGSVELVNNQFAALPRIYRRQGRGHRNSVSEGSKPLNVADDQTPTPSSPVPATNEIS… |
| M3ACT5 | 101-400 | SIGSQTPTADSVSNLKPPFVRFGFETAFEILLQKFSITSNPAAKLGHIYDIDKLLLPYMMEQGTRGSPSASFMRHASGDAQLENDAS… |
| A0A4U0XTG3 | 597-908 | None |
| A0A2S7QQ08 | 911-1229 | None |
| A0A4U0X3W7 | 3-340 | None |
| A0A170R074 | 1-277 | None |
| A0A4V5N7A2 | 985-1266 | None |
| F2PRY8 | 927-1213 | None |
| C1H0H9 | 1355-1665 | None |
| A0A4U0TR63 | 730-1057 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.