DPCstruct | MC14207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 249 ± 17 aa |
| Standard deviation of domain lengths | 16.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2SBB4 | 1-249 | MATDFKIYILLKSDTLATQNVDQKLHNTKIWHKFQGERYLFMVCSGILDTIPDLFSVDDLFIRNNKEDFIDAAIDASTSSYIWGVYA… |
| A0A0J8QSY5 | 1-242 | MASSVQVYYVPNNTIGPMFSSMRAERSIYAGSGWFIAATEKPEIPEAQDLSLTFSCNDQSFVDAAAVAERISPGQYIAYRKIIKQRK… |
| A0A178EUR2 | 176-431 | None |
| F0UGL8 | 314-538 | None |
| A6RHE5 | 673-927 | None |
| A0A0G2I7D0 | 1-236 | None |
| A0A0G2ICI6 | 2-253 | None |
| F2Q270 | 189-449 | None |
| F2PNI1 | 1-281 | None |
| A0A022W6M7 | 1-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.