DPCstruct | MC14205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 243 ± 25 aa |
| Standard deviation of domain lengths | 24.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.80 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0229- PF03455 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8QM79 | 1-228 | MPQAFQQPMKNPVGSTLIEGHCLQLQQIDDKSICSICDEKAEDAMYRCSGCKIIVHGRCASQICLVCTVAFHPDQIRAAFVRCFASL… |
| A0A075AML1 | 147-381 | TTQTPLIGENTRIVTPKMTKEEHTLVVKPQSEINSTSDCHICRHPIKDDNLMQCVNCPLTIHENCVSSLVYPCYSVFKEDLIESSFL… |
| A0A0G4MGG5 | 419-697 | None |
| M7T9F2 | 1-283 | None |
| A0A074WFL7 | 116-333 | None |
| A0A420HV05 | 637-873 | None |
| A0A3A3A070 | 496-717 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.