DPCstruct | MC14204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Standard deviation of domain lengths | 10.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.30 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | PF01267- PF06732 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A044V441 | 1-116 | MRIKKKYESGAATNYITRGRALKKLQLSLKDFRRLCILKGIYPHEPSHKKKVNKGSTENRVYYYAKDINFLASEPIIKKFREYKIFL… |
| A0A0J8QLP4 | 2-118 | AKIKKKGTSGAAKNYITRTQAVRKLQISLPDFRRLCIFKGIYPREPRNKKKASKTSTPSTTFYYTRDIQYLLHEPLLKRFRDQKALF… |
| A9BK35 | 1-119 | None |
| A0A139H693 | 454-571 | None |
| A0A5Q3CYN9 | 1-109 | None |
| V6TEQ9 | 6-116 | None |
| A0A2J8AGT9 | 1-112 | None |
| A0A812C8B1 | 1-107 | None |
| A0A7R8ZZI0 | 64-159 | None |
| A0A6V7X6B6 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.