DPCstruct | MC142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 184 ± 16 aa |
| Standard deviation of domain lengths | 16.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8V204 | 20-187 | SKGAFTETEGARRKPANELTLMETLNRFREQFTQKSHHEIVFNPQHLLRALEVYLTQFDGWDWDKRDLFWRQVIGFVQRFLPACDAE… |
| A0A1F8VDR5 | 260-445 | TTISAASATDVKTMLSQKQADSELGQAIRAFREKIKDLSINNKKDPVSNPFYLQEAFHLYDECFNTFTTWDQRDLFCIQGIGYVQCY… |
| A0A0W0TNQ9 | 130-334 | None |
| Q45909 | 5-180 | None |
| X1CFM0 | 50-246 | None |
| A0A1F8VEK1 | 374-542 | None |
| A0A1G0G7M0 | 296-501 | None |
| A0A1F8V3I2 | 269-455 | None |
| A0A1F8V242 | 2-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.