DPCstruct | MC14197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.95 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0184- CL0631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9N0W4 | 31-92 | QEIFDYVKARYNTVPDYPWHDANAVLRHADNRKWYGLVMEVGRDKIGLSGDGTVDVINVKCD |
| A0A3R7BUG5 | 2-65 | NRKELEEYIRSNYSAEPDHPWVKYPNYIVFRHQSNKKWFAIIMDVPKNKLGLQENDILDVVNFK |
| A0A2S6BAF2 | 2-57 | None |
| A0A380FI61 | 4-56 | None |
| A0A811IFH5 | 1-72 | None |
| A0A1C6HGQ4 | 31-101 | None |
| F4LLW1 | 100-170 | None |
| R6J2V7 | 1-53 | None |
| A0A6I2UYA2 | 2-73 | None |
| A0A0B6FQB7 | 201-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.