DPCstruct | MC14190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 205 ± 32 aa |
| Standard deviation of domain lengths | 31.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847GKE9 | 11-240 | RGGRTQFFYSHWGALSLAQDIIWGPDETTRFMRSLPPTDELLDDAFCEGAALVDWDARRLIWFEGDCLVQGPMQRQLYTRLLEQIWS… |
| A0A2P8FBU7 | 16-212 | RIYHDRWGASRIPYDLYLGENAFLEYVKECTITEHLREHGWMEGFVIADIEKKLLGFWSWELEHETSVVHYFLAALKKKWPGWQLMH… |
| A0A5C7N4U9 | 15-198 | None |
| A0A542ZPA5 | 44-280 | None |
| A0A7C7WT80 | 10-243 | None |
| A0A4U1H7N4 | 13-242 | None |
| A0A4R9E803 | 50-220 | None |
| A0A554GQT0 | 1-146 | None |
| A1A1S3 | 373-598 | None |
| A0A1I2C589 | 1-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.