DPCstruct | MC1419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 218 ± 21 aa |
| Standard deviation of domain lengths | 21.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A6NT29 | 37-252 | GVKKMERKKRLDEIHGQIMELKDRFKHLGYRLIQEGERLKNPGCPPDDVLFQEVAEETKKFKLLTEKLAAAGRALSWSGLNGGVDSL… |
| A0A538RAV6 | 12-212 | ARDLLRKNADLATWMAELGARGSAAAIALTGAGTPPPDDLIQELAEAGREFIALRAEVFALAAALGLTTPSAGAIDCTKRLDAMLRL… |
| A0A350C0P0 | 1-269 | None |
| A0A534SD87 | 1-242 | None |
| A0A2N2F8X4 | 7-225 | None |
| A0A2V6TZU8 | 1-248 | None |
| K9TQI8 | 1-233 | None |
| A0A517Z2U0 | 33-233 | None |
| A0A1N6E4A7 | 265-477 | None |
| A0A2E3GWG4 | 4-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.