DPCstruct | MC14188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 7.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 38.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14921 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A667H1P1 | 82-149 | CEVRSGPEFITRSYRFYHNNTFKAYQFYYGGNRCTSPTYTLVIRGKVRLRQASWIIRGGTEADYQLHN |
| A0A5N4CHK1 | 14-89 | CEVRSGPEFLTRSYRFYHNNTFKAYQFYYRGNRCASPTYTLVVRGKIRLRQASWIIRGGTEADYQLHRVQVICHSE |
| A0A6H5G0I5 | 123-203 | None |
| B7PBL6 | 37-132 | None |
| B7PBL4 | 2-79 | None |
| A0A5B7J367 | 22-88 | None |
| A0A6A4JVV2 | 4-78 | None |
| A0A0J7KL51 | 22-102 | None |
| A0A4W5KKJ6 | 129-212 | None |
| A0A1S3QTM1 | 6-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.