DPCstruct | MC14187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 101 ± 4 aa |
| Standard deviation of domain lengths | 3.62 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 15.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0648 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9XCW4 | 63-169 | YEITDGRVFGLLGFTRKGNSSLLYSSDGETVVVSTPIAVDDVFFYGRHSYSKAFVTIRGDIEAKIARIDANSIVRMPYNGGTTSKLE… |
| A0A1D2MI95 | 86-185 | GEAKLYNGSLKNMDTIHRTGAADITILPDGDIVIAADAGVNYGELDYDMSVEFMDLGPHVAVKGKLSKVRVLIQLRVTSSLNVTMEK… |
| A0A7R9QB05 | 369-471 | None |
| A0A4Y2S3Z2 | 133-234 | None |
| A0A7M7KTC6 | 94-197 | None |
| A0A7J7BTA8 | 3-98 | None |
| A0A0K2TGY6 | 134-229 | None |
| A0A226EFI4 | 73-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.