DPCstruct | MC14184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 162 ± 10 aa |
| Standard deviation of domain lengths | 10.39 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540PKU9 | 2-166 | AMVGLFCIAEDGEVYVGGEPEGYARGVRLTRGGLEGLGTGQGGRWSWADVRAVVVRDVRVRSSARLLASTAVDLALTVAMGGTDVPG… |
| A0A2U0XQU9 | 1-173 | MTIANLGPLEFVSGEWIVGDSTAPKSKYFKLDRQGLGYWVQGVRAEMIPWSRFMNLGLSIQASQLGNSRTLARITDLALSLTGSSRH… |
| A0A1Q4WCA0 | 24-192 | None |
| A0A022M6N1 | 7-168 | None |
| A0A1R4HVY2 | 1-160 | None |
| A0A7U9DQC9 | 618-784 | None |
| A0A429N3D3 | 5-174 | None |
| A0A429N2N0 | 1-147 | None |
| A0A0K8PRD7 | 128-292 | None |
| A0A399JF95 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.