DPCstruct | MC1418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7B222 | 16-92 | MDKHTLGPKIRQGIRDGLLPTQRPSRTWFGFAQGDTSCAACGQPVAIRELECEAEFPGEPRTYLFHAACFEAWQTER |
| A0A538R0Z4 | 80-168 | SERDSILSIVRAKLVTGTLPRGEIQKVWVGLGTGRQCSACDRPITPAEIEHEADLVAGSTLRLHRSCLGVWEAEVSRYGREIGGGSV… |
| A0A2V6TGS4 | 1-71 | None |
| A0A2V6SBK0 | 2-96 | None |
| A0A2V6Z5J1 | 1-83 | None |
| A0A2V6YT22 | 158-244 | None |
| A0A2V6QHL6 | 26-119 | None |
| A0A2V6YNC4 | 1-88 | None |
| A0A2V6TFG8 | 53-118 | None |
| A0A2V6Q209 | 6-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.