DPCstruct | MC14175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 217 ± 29 aa |
| Standard deviation of domain lengths | 29.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218Z0K6 | 1-229 | MAKLVDVCGHEGPGAFLGVATATFATPTAAQLASWKAVTSPTTSPMSAVESSSKRSESDSASRRSSVSTVLSTAPSTHQDQPSTSIP… |
| A0A2V1BXG6 | 1-184 | MAVTTSTCRHQLQSANYHKEWESNAGSHPGSRSDYASSISSVGCKTPPWESISSASHYVATYDYDLSCECAPLGCGVRFQPERFEEW… |
| A0A6C1LR66 | 1-186 | None |
| F7VP24 | 13-259 | None |
| A0A059J7K7 | 7-218 | None |
| A0A4Q4XDB2 | 1-185 | None |
| A0A2K1QPQ4 | 96-329 | None |
| A0A6V8H8X6 | 1-207 | None |
| R1EBG3 | 59-284 | None |
| A0A167WNF1 | 147-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.