DPCstruct | MC14172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 98 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.34 |
| Pfam Score | 16.67 |
| Assigned Pfam label(s) | CL0123- PF18790- PF18821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T1B5A0 | 65-159 | REVPPEIKAAAQQRFGADIRMGVPRENGLYKGEVFNTDRYLVQEVATRSVVFHDKQNMEFADSRLKWCNENQRLNGADVQVGYTGDQ… |
| C9YBG7 | 9-96 | LDDMVAWVTASQGELEEVLAERQYCGPVLKMSEHHALQKIGRRNYTIHKLDELNSIPELNHPKTTIRYRDGRGSILDDDSLHGGGVAH |
| C6XEQ4 | 299-398 | None |
| C6XEQ8 | 70-166 | None |
| C6XEQ6 | 248-355 | None |
| C6XEQ5 | 111-211 | None |
| A0A5E7QH44 | 82-202 | None |
| A0A848P2V5 | 236-335 | None |
| A0A6S7ARC5 | 55-163 | None |
| G9G7L8 | 22-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.