DPCstruct | MC1417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 132 ± 16 aa |
| Standard deviation of domain lengths | 15.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6K872 | 424-528 | AEFTPLKQAPPLEKTDLKKISWLKEYLTDDAADHVSVTLKEHSYNLALKPGEETFGKCNVNYMSGECRHFQKCALAIFEDDVAEFLP… |
| A0A067R4G9 | 2-140 | ESLPKAQDEPVTLQSSRPPSYLTTRLEIGSPEVTTQINEEYREVLDNVDDLEWLSGVTNGSDMVVLPLGENGTAKIFRLGINETSAD… |
| A0A1B6MBC3 | 2-148 | None |
| A0A2J7PM27 | 198-328 | None |
| A0A2J7PM23 | 1-139 | None |
| A0A834M561 | 1-131 | None |
| A0A2P8YWQ4 | 891-1003 | None |
| C4WY73 | 78-206 | None |
| A0A7R9H8J4 | 52-188 | None |
| A0A811WIU9 | 38-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.