DPCstruct | MC14169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 123 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 32.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1KZ49 | 2-126 | GNITTSADLKLEIQVLEEQQTFHAIQLREQFFLITESLKPANLIANTLNEMKSSPYLANNAISAAIGLTAGYLSRKAVIRESDSNLR… |
| A0A653VKA7 | 1-111 | MKTITENQILDEKIRLLKLKKENQFEVLKQQFNETLDSLKPVNIVKETIKDFKNSKEIKNSLLETSLGIAGGYLTRKLIVGESAGIF… |
| A0A1M5JJC9 | 1-116 | None |
| A0A4R2ENB2 | 1-133 | None |
| A0A7Y7NFT1 | 1-123 | None |
| A0A399CUX1 | 1-127 | None |
| A0A6L4Z4T8 | 1-126 | None |
| A0A1J5AJW7 | 7-125 | None |
| A0A3B9T884 | 1-127 | None |
| A0A7K3XDA7 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.