DPCstruct | MC14168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 307 ± 34 aa |
| Standard deviation of domain lengths | 34.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T1EAM5 | 2-291 | SHFPIILIPSSIQQAKSAHPPTLIFPDSLPQHPGTKPQKINNPLIAVEVALTIIISTVITSGGGAGWGFLSFVTAACAITFQAWQQI… |
| A0A3C2D8H6 | 4-295 | FPQYPIIKVPSHLLSVKGSIPGLKIPPPRLPIKPELKQISKPILPTKQEFDLNDGCFKYILYFAAIGCLMLWVATNARNKEAGAEAG… |
| A0A1M5K2I0 | 144-457 | None |
| J1FM67 | 73-403 | None |
| A0A7Y5R9G7 | 3-301 | None |
| A0A2C6CJC9 | 12-323 | None |
| A0A5C0DRN3 | 59-313 | None |
| A0A3C2AKF8 | 4-360 | None |
| E1WQE1 | 205-578 | None |
| R6SVI1 | 9-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.