DPCstruct | MC14167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 13.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q5TTQ8 | 25-158 | KAFLRDLFPDHNFDGDITDRVGSYEDACAIVGINPMTIDNFKPFPEQDREYHFASHKLVTIARVLNEGWQPNWNDSTQAKYYPWFKP… |
| A0A3C2D3X0 | 6-132 | VKNQPVFDFRTIKTFEDACTKENIDPTALPDVSMIPKEFRKPIINAYKLLIIFKAINDGWRPDWSKLSQYKYFPWYRVLSSGFGFSY… |
| A0A6A2FL84 | 20-150 | None |
| A0A2Z4IP81 | 1-125 | None |
| A0A0Q5THC2 | 18-136 | None |
| A0A3R6IWS1 | 85-231 | None |
| A0A1Y3WE77 | 1-120 | None |
| K1T1A1 | 6-123 | None |
| A0A1Y4CFY1 | 57-204 | None |
| A0A0Q5UAA2 | 4-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.