DPCstruct | MC14163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 168 ± 24 aa |
| Standard deviation of domain lengths | 23.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7IW19 | 33-181 | FYLKDSLLPVYNPFFYHYSRSDLSQAEQYQQKTRSKSDRKLQACPPPMPCDFEPFFAPAANILKTPCLIKILKLVLDRTGKRSRFSS… |
| A0A6A5GPT4 | 2-137 | HYSKSDQLAAEQSQARVRENLNKNIRACAPPVLPDFLPFFEQIPMLLKSGILIHVFRIVIDRTTRRSRFSSDRLFHKVLYLIGIALN… |
| A0A2I0TTB3 | 523-715 | None |
| J9BHF3 | 382-566 | None |
| A0A2W1BLZ8 | 773-920 | None |
| A0A6S7FLW7 | 37-206 | None |
| A0A556TRA1 | 717-926 | None |
| A0A0V0TR96 | 77-244 | None |
| A0A452U1Q2 | 114-286 | None |
| A0A452QVW6 | 106-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.