DPCstruct | MC14162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 83 ± 4 aa |
| Standard deviation of domain lengths | 3.92 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5TRC7 | 1-88 | MDNKQAPICGSIIFVMMKRNPKVNYSSELLTSLQKNHVLLRIIGSNQMLGGDDTSIMYNLAVKTDGMYVFSDDDRFGWVSDFFIYEPT |
| A0A1I7TTP4 | 16-98 | FQKFLSNRIAPICGSRIFILLKRFPNENYTSTLIETLQMNHISMDVITSITPSGGLYHQTMYEIATRTNGICAFENDDHFAQT |
| G0PH93 | 1-88 | None |
| G0NCN7 | 292-375 | None |
| A8XMV1 | 22-104 | None |
| A0A6A5GK24 | 223-298 | None |
| A0A1I7T7M4 | 43-123 | None |
| A0A6A5GW99 | 3-79 | None |
| A0A1I7TTT4 | 61-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.