DPCstruct | MC14161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 213 ± 29 aa |
| Standard deviation of domain lengths | 28.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5GK35 | 1-209 | MRRKRPRIEDSGSDGNTEVSTNPFDMSRWSYMRRMLDPISFMMVNIKLRDEDDTSLLESEARKIGAVIQNIHTYRMPCGEGRYFQIF… |
| G0NJ22 | 84-321 | AGEMVRRDASSRDEASTSLPPSQPTSSAPPHQPPVSILRRPSSESSDGFSTSKRRRRHVSFAEVDSDKEKEAAFMLVNVPTKHPKID… |
| A0A2G5UUP1 | 474-745 | None |
| E3N0F0 | 26-242 | None |
| A0A2G5UMZ9 | 154-361 | None |
| A0A2G5UN72 | 44-226 | None |
| A0A2G5UN75 | 534-709 | None |
| A0A2G5UND6 | 482-680 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.