DPCstruct | MC1416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 61 ± 1 aa |
| Standard deviation of domain lengths | 1.39 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4Q1R7 | 21-82 | LDFAEEQLRCTNCIICVQKSRPDRATLLRTFMFMGFQPLPPNSPMMREIAKPDYIFLHYNMQ |
| A0A067R3B1 | 1-63 | MLEYAEEVLKCTDVIVCFKKDCNDRALIVRTFMYMGFTTLPPGHQLIPGNTDTGIMYMLCSIE |
| V9LB21 | 1-59 | None |
| A0A814KJC6 | 197-256 | None |
| A0A2A4K0I7 | 183-243 | None |
| A0A6F9B641 | 124-182 | None |
| A0A814CJP4 | 219-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.