DPCstruct | MC14158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 262 ± 40 aa |
| Standard deviation of domain lengths | 39.74 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.27 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0192- PF01579 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5TNI0 | 31-330 | KECTPLGNKLKAYMSRHEGYRLPPDVYQNCTILCGSITKCYNELKCNNAQELKEDFEIRCSKLEYLTASIHHCMNRFSNAVYQRTYE… |
| A0A6A5GFV1 | 46-288 | TNCLEAQRNKETYTQKCQKLDFKNYGMHKCMPYFYKMAYNQENSCASKYDFFTNDLKTKRIAFTSGKQCLLEIVSVKCSKKTMAYLN… |
| A0A2P4UYP3 | 8-320 | None |
| A0A2G5TAH2 | 1-207 | None |
| A0A2G5T8Y3 | 21-249 | None |
| G0NL87 | 81-348 | None |
| G0MT64 | 17-265 | None |
| G0MAL8 | 74-259 | None |
| G0M9X8 | 365-622 | None |
| G0M9Y1 | 7-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.