DPCstruct | MC14157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 157 ± 40 aa |
| Standard deviation of domain lengths | 39.98 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8BP39 | 38-218 | GAITFATYIFYIYFKSSNMELNFRLSCILSILGLGVFHVVTFPWPFLSNPLQVYTEKERLAYKIEHLPSDLEPVGCNTDKFNWCQST… |
| A0A6A5GF29 | 2-152 | LIGLGFFLLYQVFMYPWNLYSGPLDYLPDGEDTDVAGGCYQTYEWCKWTTRVPLPIYLICFIVFFGVAFPFVESPSAALYSEILGPR… |
| A0A1Y1K1H7 | 140-348 | None |
| A0A0N5A6S0 | 76-172 | None |
| A0A2M4CI88 | 84-365 | None |
| A0A1I7YMG3 | 16-163 | None |
| A0A6V7W9W8 | 44-214 | None |
| A0A0M3IBU5 | 52-156 | None |
| A0A4U5MJ95 | 1-115 | None |
| A0A811LX76 | 7-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.