DPCstruct | MC14151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 170 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4HKH3 | 1-172 | MNVEELFKKISIRGRFAFGIMCIEEYLLENSIKDFWIEKLLIHLWEFTESDNLDVWDEKISDLNPYNILEVDYEEYPNDFPTINASE… |
| A0A1M6E1T0 | 1-193 | MALLLNCIRSGIPAPGSGKPCATKNRTVKLDAYLEQARPLSLTARAAISLHITEAYFLKKGLKHEIVDEFFDHLWQHPLQQEPKAFS… |
| A0A1H7P309 | 7-189 | None |
| A0A1Y4HY33 | 80-263 | None |
| A0A1W1UJS2 | 241-395 | None |
| A0A222FB67 | 15-173 | None |
| A0A7Y9JXY8 | 15-164 | None |
| A0A1D7XPH6 | 5-153 | None |
| A0A023BTT8 | 1-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.