DPCstruct | MC1415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08409 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7Q9H6 | 16-106 | FRLWMLHGTLPQFSEVDNPASFSSRLSTRLLTYSYLGAFNAWLVLCPRTLSYDWQMGSIPLVSSLLDPRNLATVALGTVLVLLFWRA… |
| A0A067R1Y3 | 2-95 | MRLQIMGSRLPVFTRFDNPASVAPTPVRQLSYNYLISVNLWLMLFPCDLCCDWTMGTVPLVESLLDARNLVTLISYAILSLLTYVAV… |
| A0A3P7ZEK3 | 33-132 | None |
| E9HMJ6 | 10-86 | None |
| A0A3Q0EH43 | 245-331 | None |
| E9IFH6 | 61-152 | None |
| A0A5N5THV0 | 258-354 | None |
| G3HPI1 | 4-84 | None |
| R7T7X8 | 127-214 | None |
| A0A1D2NLT1 | 410-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.