DPCstruct | MC14147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P9KYM8 | 1-94 | MNPTTPDGRYFVVKGQLWRCSNPFLSDDVRQHLVDELMAARRAVKAAKASEDPAALKVARASVDKAKVALGERGEVWWTDGAEDFNR… |
| A0A2M9CF33 | 7-98 | DEERWLVIGGRRWRRTDPALPDDVVARLRSHLGRGRAGVRTATRSGDEAAVAAARHRVNLAKHALGERGPKWWESDERARLERAHAG… |
| A0A0B4XHZ5 | 61-146 | None |
| A0A364VB16 | 2-80 | None |
| E3BCP9 | 4-89 | None |
| A0A1I5DF17 | 20-115 | None |
| A0A660LHM2 | 3-76 | None |
| A0A7W6FZG5 | 4-98 | None |
| A0A1Q4DUW1 | 1-63 | None |
| A0A177UN35 | 11-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.