DPCstruct | MC14145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 223 ± 13 aa |
| Standard deviation of domain lengths | 12.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381C4G8 | 80-325 | VGFNVVAQAQKLLLRNFILTLDRQTSLDKCLIATIESLIELVSECASKRPKKSSPAKGVTINSQRKLGFCEFCGNQTEYSQFISEIS… |
| A0A235CI08 | 4-215 | TQDNEDSRFYDTAETLLELLIHCRSKQPAKRKSVSSQFNLQRPKELCFLCGAPSEFLEYFSNHESWALIDDDEKLKLSHKYCYKHRP… |
| A0A1I3ZW83 | 193-420 | None |
| A0A3C0JE69 | 26-225 | None |
| A0A550FQE4 | 111-330 | None |
| A0A828TZV3 | 12-255 | None |
| A0A243T3Z9 | 87-310 | None |
| F8FYH5 | 6-231 | None |
| A0A4Q7MZI2 | 82-283 | None |
| A0A7U7EQZ0 | 134-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.