DPCstruct | MC14142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 130 |
|---|---|
| Mean domain length (aa) | 109 ± 18 aa |
| Standard deviation of domain lengths | 18.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.76 |
| Pfam Score | 94.85 |
| Assigned Pfam label(s) | PF00347- CL0267- CL0376- CL0177- CL0269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397TZV5 | 140-249 | GTTRALIANYIRGVSEGYKVSLKFVGVGYRASLESDGKLYLEVGYVNPVVMEIPPDIKCIVPAPTKIILSGTDKQLVYRFAAQIREH… |
| A0A096Y6X9 | 22-140 | NIKKKYQIIKIIQQIKSLSTIKLKLTGVGFKVRNFLLNNCNKHFLQLFLGKSHKIFIVIPKDITLQSKKNVIKLSCYNLQTLNLFVV… |
| A0A7S2QP29 | 113-225 | None |
| A0A7J6L6J7 | 549-673 | None |
| A0A6V8HNK8 | 462-600 | None |
| A0A803QES2 | 303-401 | None |
| A0A645JIJ7 | 5-85 | None |
| A0A834T6P5 | 328-456 | None |
| A0A0K9QCB7 | 5-99 | None |
| A0A821IKZ1 | 4-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.