DPCstruct | MC14139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Standard deviation of domain lengths | 5.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EK27 | 152-201 | AHMCGYCEIIFLNRTLYYLHMGLHNVNNPLQCNMCGKACENIHDFSAHVM |
| A0A182H9Y4 | 1-66 | MLLSGGPKSKRHLQCLFCGIEFPDQTLYFLHKGCHSESNPWKCNICGEQMCNVYEFNSHLLSKSHQ |
| A0A6J8ETN0 | 123-177 | None |
| A0A060WNF2 | 181-246 | None |
| A0A821T960 | 547-604 | None |
| A0A6F9CPM4 | 358-423 | None |
| A0A2K6VS75 | 1369-1421 | None |
| A0A816HU39 | 66-132 | None |
| T1PM93 | 223-288 | None |
| A0A8B6E0R3 | 554-603 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.