DPCstruct | MC14138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 194 ± 22 aa |
| Standard deviation of domain lengths | 22.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182H4J4 | 17-216 | LKPLFYEIVKQCERKNIRYDKHLVTFVMNLVSLDPQFEIYMETLSADRRNHDDFVEECVQRLSEDRSPALVTLKMQLYFLENFFNRD… |
| A0A820BS54 | 11-202 | EGVIKNIIREIVQECASRGEGVSETLVAFIVKAVVLEPQNDFQVDRVLASDDVKRLIDLCVRRLLDNKSSSLDTIKMQVYFDMNYTT… |
| A0A7J6RXY8 | 4-258 | None |
| A0A815KES0 | 11-214 | None |
| A0A7J6KZS0 | 4-217 | None |
| A0A672GDE8 | 10-210 | None |
| A0A0G4EZJ4 | 5-214 | None |
| A0A1A9ZAU8 | 14-210 | None |
| A0A3B3YJG0 | 10-202 | None |
| A0A068Y4M2 | 2-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.