DPCstruct | MC14134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 173 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 64.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183I9A1 | 51-210 | VLDDSHKPISPPVKSGPKTPSRRGGNIFFGSSFNSDMLTDSFATKKEFESDTSPLCSPITPKTPLENWEKSSSRKLLDERRRLVVEL… |
| A0A182GW74 | 1-155 | MEEDHPQQQQHHPHHHHPSAQLTSDSSAPLSSTATPSSAYIVGNRFFGPDFNMEQYKDMAADNTDRSPRTPKTPSARSVNSAEEKGH… |
| G7YTA7 | 8-178 | None |
| A0A060XNB4 | 25-217 | None |
| A0A060XXC7 | 20-191 | None |
| A0A2G8LH70 | 150-299 | None |
| A0A1A9X434 | 138-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.