DPCstruct | MC14130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 247 ± 35 aa |
| Standard deviation of domain lengths | 34.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.22 |
| Pfam Score | 74.64 |
| Assigned Pfam label(s) | PF01424- CL0196- CL0221- CL0449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9L1D4 | 233-446 | DLVLIEHEEWSLDRQKHSHCILNQSATQCGCLLEWITEPENGCFRCTIKLQGEEISSCLAKQRKVAVSLASSKALFQLFESQPLVHR… |
| A0A182GMR0 | 207-492 | FILLDDNLEDSGREFGMLNCGLFVVRVVSQERKQWVASVTAAGYLLSKSNGPKKKANRACREEALQLLRRKCYKIRTNPNRCWDSCN… |
| A0A182U7F9 | 684-939 | None |
| A0A4Y2BE54 | 569-788 | None |
| A0A094ZEF5 | 201-473 | None |
| A0A6P9ABB2 | 318-569 | None |
| A0A835NM68 | 334-572 | None |
| L8Y3H6 | 253-500 | None |
| A0A7J6BA45 | 953-1202 | None |
| A0A5N6ED90 | 69-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.