DPCstruct | MC1413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 137 ± 22 aa |
| Standard deviation of domain lengths | 21.66 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.90 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF00557- CL0718 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482WBD3 | 1-144 | MAETQVNPSANAPTCMESVNRIAKLPVVESSIQTASNIYEKIKDYNGVTQWTCSTAENVVNKAVEVGKPIAVPIVQGLEGPIKKVDD… |
| A0A067QWI1 | 32-162 | LEGDSRPDDIFPIRMASVVRVSKLPVIEQTSNIAVNVYKKVKKSNCVFNWSLKKAESTVSKAVKSTEPVVLRLRTPITKVDGLLCVG… |
| A0A6J2YUN8 | 1-178 | None |
| F4WXU0 | 79-194 | None |
| A0A1Y1Y8U3 | 2-155 | None |
| A0A195D506 | 1-118 | None |
| A0A653C8J8 | 1-133 | None |
| A0A7I0Z501 | 3-186 | None |
| A0A6H5H0A7 | 267-379 | None |
| A0A6J1TDN1 | 2-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.