DPCstruct | MC14129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 107 ± 17 aa |
| Standard deviation of domain lengths | 17.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 67.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q32PN8 | 32-126 | MEDEDLFCLQYDMNDCYSRLKRLVPTIPQDKKVSKVEILQHVIDYILDLQLALETHPALLKQTSPPASTRTPLTQINTEQRTTGVNK… |
| A0A182GM05 | 4-127 | MPNAEIQMYLSKLKDLVPFMPKNRKLSKLEVIQNVIDYICDLQSALESHPAVNSFDPVQALASHQSAVEPMESTPVGPRQPLGVRPS… |
| A0A1J1IPK2 | 1-148 | None |
| A0A7F8RKN1 | 1-94 | None |
| A0A1A9UVR5 | 22-132 | None |
| H3AFJ0 | 34-134 | None |
| A0A7J6AKU2 | 84-159 | None |
| A0A2P8Y9R0 | 118-242 | None |
| S9XVC1 | 39-107 | None |
| A0A835L1M1 | 104-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.