DPCstruct | MC14128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 265 |
|---|---|
| Mean domain length (aa) | 111 ± 20 aa |
| Standard deviation of domain lengths | 19.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.63 |
| Pfam Score | 97.56 |
| Assigned Pfam label(s) | PF04621- CL0123- CL0168- PF01130- PF20772 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7RYB7 | 1-90 | IQLWQFLLELLTDKTCRHLIMWVGEEGEFKLNDPEQVAQQWGKRKNKPAMNYEKLSRALRYYYDGDMIHKVHGKRFVYKFVCNLKNL… |
| A0A182GI37 | 16-117 | GAPNTSSTGTGKPRQGGSHIHLWQFLKELLATPDQHGTAIRWIDRTKGVFKIEDSVRVARLWGRRKNRPAMNYDKLSRSIRQYYKKG… |
| A0A182FWX7 | 205-324 | None |
| A0A182FHX1 | 31-110 | None |
| A0A1D2NAZ0 | 187-314 | None |
| A0A2B4SMQ1 | 491-615 | None |
| A0A2B4SHU3 | 274-385 | None |
| A0A2B4SFI0 | 664-772 | None |
| A0A7E4WE70 | 2-99 | None |
| A0A7E4VYD6 | 218-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.