DPCstruct | MC14125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 350 ± 34 aa |
| Standard deviation of domain lengths | 33.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.72 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0771- CL0418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3ZBN9 | 3-330 | IVLISCTSKKKAYGCPARELYSESPRFCLSYDLAKRIGDKIFILSGKYGLVPDHKVIEPYNETLKDKSIQERRIWANDVLSELREVS… |
| A0A5Q2FCC5 | 42-409 | EPEPQPPAPEPRVPEPRATPAAVSRRPAARSEQERPVVATRPDIVLIEEDREQGRTPAPAGDLFTGPLFTRAKAYARWTGAPWFILS… |
| A0A2E2AV41 | 88-456 | None |
| A0A847BKV4 | 1-342 | None |
| A0A1H9MJM4 | 100-390 | None |
| A0A838SIQ1 | 2-348 | None |
| A0A359IS48 | 76-413 | None |
| A0A4Q5THY5 | 123-538 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.