DPCstruct | MC14123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 254 ± 48 aa |
| Standard deviation of domain lengths | 48.05 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06122 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3EMZ0 | 1-193 | MSDLISGGSVEIYSCDSDTTNCLSAGSSNKTVVLKGIKNQITDMLLGTSSTPGVIYKYATNSGTLTDPEKAFVSNLPGGIGTIVRNL… |
| A0A353WLB7 | 19-233 | MSLSGTIVYGTAGKVKIFSPLAKDRKVLKALLEGGEAEIYKCDEEKQCLNPQLTKIKVSKEKALYEKVSITINEIVAAVANDHNPLD… |
| A0A0B5FWX0 | 7-250 | None |
| A0A377LN23 | 32-280 | None |
| A0A6G9QRH6 | 43-293 | None |
| A0A0E3BXG3 | 112-367 | None |
| A0A7W6Z5M7 | 38-433 | None |
| A0A7R9NA73 | 187-410 | None |
| A0A2U7XX02 | 28-252 | None |
| A0A2S5CIV2 | 78-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.