DPCstruct | MC14120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 428 ± 76 aa |
| Standard deviation of domain lengths | 75.69 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.15 |
| Pfam Score | 97.10 |
| Assigned Pfam label(s) | PF12621- PF06415- CL0021- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538FCX4 | 210-659 | SGTPVFDALWARYPHTTLDASGRAVGLPEGQMGNSEVGHLTIGSGRILDQDLQRVNRAIEEGSFFENAALVGAFERAKHRGTNVHLL… |
| A0A3P8KC69 | 2-386 | GLLSPGGVHSLEDHLFKLIDMAHTYGLKKVSVHAFGDGRDVAPKSILDSLKKLQAQVDKYGYKIASIGGRFYGMDRDKMFDRVEKHY… |
| A0A084U447 | 26-514 | None |
| A0A4Y7LDF0 | 36-452 | None |
| A0A2G9ZM99 | 36-513 | None |
| A0A381GWU9 | 2-235 | None |
| A0A3L6RX52 | 405-851 | None |
| A0A2P4VEA2 | 28-438 | None |
| A0A7V6PWK2 | 2-314 | None |
| A0A836AUN9 | 450-969 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.