DPCstruct | MC1412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 280 ± 20 aa |
| Standard deviation of domain lengths | 19.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067QRM7 | 4-258 | VTAMKKKIKYPKKSSLNAEQQAMYLQLLVKFAKKHSPFPTPLEQKELQQYEAFHDKVVAERFEFIHFVKQRCALTQDRYLVINPDVK… |
| A0A0N4UDB4 | 165-448 | WAPHIHPLLKNKVSVLNRLVDHQRYVAIASNFLNPEPLLRYQHNRKELQMMDNKLLDERREYQKIVSDYVLKKKQTLFSCSDKAVHY… |
| A0A1S3PER0 | 106-400 | None |
| A0A0N4V3P6 | 167-423 | None |
| A0A3B4A2T7 | 29-304 | None |
| A0A2P8XHG3 | 35-307 | None |
| A0A7F5REJ1 | 37-314 | None |
| A0A3P8QEX1 | 1-280 | None |
| A0A6P5A8N2 | 90-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.