DPCstruct | MC14119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 113 ± 8 aa |
| Standard deviation of domain lengths | 7.63 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 21.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538FBI9 | 3-118 | DEVRAAGKVANAHESGDRIPFPSAVFVGEDGARHGVYGAAGYDELKGAAEAAGAVNSAADPPAVTDALRRFGRMATREIEEVCRLPE… |
| A0A3C1PKQ8 | 16-122 | KLGRELGIRGFPTIFFTDTIGNKEMVYGSKPYNTFENALLKLLPTASKTTYDKTWSSVFSIYHLLKAKEFSVLTGTPRNECEKYLDD… |
| A0A0R2RVY4 | 1-95 | None |
| A0A7V1BVT5 | 67-177 | None |
| A0A0M3CEE5 | 79-195 | None |
| A0A7C6Y8H7 | 143-264 | None |
| A0A2T6EQB7 | 4-109 | None |
| A0A640Y9K3 | 246-363 | None |
| A0A0A7MD35 | 2-109 | None |
| W1WRV5 | 49-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.