DPCstruct | MC14116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 194 ± 17 aa |
| Standard deviation of domain lengths | 16.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8CYH1 | 14-193 | VGAWSWLLALRLIRVAGPRWRRALFACLVWATAGEIFLSLVWGLYTYRLGNIPFFIPPGHVFLFWLGVVFAPRVADLFVRGVAVLAI… |
| A0A538ETZ5 | 14-200 | RLQTLLVVGVATCMEVVGSILWGVYTYRLHNLPLFVPPGHGLVYLAGISLSETAFVRARPRAFVRAVAVCAAAWGLLGLTALPRFDL… |
| A0A1G0XI19 | 61-264 | None |
| A0A1V5X998 | 71-295 | None |
| A0A0C2ZTM9 | 56-255 | None |
| A0A7W0W915 | 56-270 | None |
| A0A535C3V6 | 41-218 | None |
| A0A401MY30 | 2-178 | None |
| A0A7K2PRG8 | 3-218 | None |
| A0A1M5MMH7 | 61-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.