DPCstruct | MC14115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 137 |
|---|---|
| Mean domain length (aa) | 149 ± 41 aa |
| Standard deviation of domain lengths | 40.63 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13298 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A413RLD4 | 2-105 | LHDHRVPRPHFDLRLEEGGVLRSWAVPRGLPTTPGRPRLAIAVPDHDLDHLTYTDDTKVIADHGWWELVDRDDRRTVFVLHGSSSTV… |
| A0A538ES72 | 2-142 | PRFVIHKHAARSLHYDFRLEVDGVLKSWAVPRGPSLDPREKRLAVEVEDHSLEYGDFEGVIGEGQYGAGAVIVWDAGEYRDLDEDRS… |
| A0A1F5B1U7 | 30-169 | None |
| A0A182U102 | 20-168 | None |
| A0A5S9NGL0 | 1-135 | None |
| A0A486XLX6 | 14-164 | None |
| A0A840W3W6 | 34-157 | None |
| Q5KLB5 | 45-323 | None |
| A0A2E5G2Y6 | 4-126 | None |
| A0A1V5QZ61 | 29-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.