DPCstruct | MC14114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 153 ± 24 aa |
| Standard deviation of domain lengths | 24.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05419 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4YG24 | 3-139 | YTSLRDALQQGDFQQADDLTRAALIKLAGPDAEKRNWVYFSEVKFISNTDLQTIDKLWRAASKNRQGFSIQKEMWMQNRKQWTKFFK… |
| A0A846EKT1 | 8-145 | SAKTTRSNKETYEVMIKAIGKKYGDIFTSDELLHFPCQHLCTIDKLWVKYSDGRFGFSIQKEMYESIAGKPNAKYDKEALNKLCKTV… |
| A0A7C3VIA3 | 286-455 | None |
| A0A803LM80 | 255-445 | None |
| A0A6I5P4F1 | 59-179 | None |
| I4IRZ6 | 895-1057 | None |
| A0A2T1EV24 | 49-264 | None |
| A0A2D0HNM4 | 328-482 | None |
| A0A367Q8P5 | 544-693 | None |
| A0A3S1I613 | 129-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.