DPCstruct | MC14112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 96 ± 18 aa |
| Standard deviation of domain lengths | 17.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 67.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2SXE7 | 48-137 | EVWTIYNKPINNPRAFKDGLIDGSEKESLKILDEKMKGILGKHYMGYEAVSAQMAFYGLSQALIPETDFDKNKQKFLEIFKVEELLL… |
| M3M5A5 | 2-116 | LFFMLPKRLILRKKEKKGKRGTIEKIQRQLDSQTGVWTIFNKPINSPRALKDGLINESEKESLKSLNKEMKNILGKHYMGYKTVSAQ… |
| M3P146 | 94-167 | None |
| S6EYD0 | 98-185 | None |
| J0JJL0 | 97-207 | None |
| A0A2A6SA52 | 48-136 | None |
| A0A1Q2PNU2 | 1-92 | None |
| A0A1Q2SBP9 | 1-76 | None |
| T5CLU6 | 52-186 | None |
| A0A1Q2QJG0 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.