DPCstruct | MC14110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2VJW4 | 99-205 | IVRPDSGELPKIVIDVLETLGKKFTCTTTSSGHKLLPPCIRVIQGDGIDINSLETVLEEMKSKGWAADNLAFGSGGALLQKLHRDTQ… |
| A0A1S4L242 | 2-88 | LETLARCFPVSENEKGYRMLPDYLRLLHSDGVTLEMADAILANVKANRWSAANVLLASDGTLLQKLDRNTLRFALQCSAATICGEEV |
| A0A4Q3P4V8 | 241-344 | None |
| A0A7Z1ZC64 | 137-245 | None |
| A0A3P7CUE6 | 1-106 | None |
| A0A378N7P3 | 2-90 | None |
| A0A813VLD6 | 293-398 | None |
| S9RVG4 | 101-181 | None |
| A0A7U0SE31 | 244-346 | None |
| A0A166C9Q6 | 201-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.