DPCstruct | MC1411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Standard deviation of domain lengths | 5.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.80 |
| Pfam Score | 91.11 |
| Assigned Pfam label(s) | CL0001- PF00683 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1P4J7 | 71-129 | ISEAKGPCFRVLRDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFREICP |
| A0A067QQK7 | 1-71 | MSIDRRQSRCYSKVEEKTGRWRCNQEIDESVTKATCCCTIGKAWGPRCELHPQEGSEEYEFLCPNNNRLQA |
| A0A1L8F8T3 | 329-380 | None |
| A0A674J8V4 | 1-63 | None |
| A0A7F8RXU9 | 91-149 | None |
| F1QFX6 | 331-389 | None |
| A0A4W5K434 | 131-201 | None |
| A0A1S3QJ82 | 9-68 | None |
| A0A6G0IA64 | 244-304 | None |
| H9ISI1 | 49-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.