DPCstruct | MC14108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 128 ± 16 aa |
| Standard deviation of domain lengths | 16.38 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.42 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0063- PF03352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0EQ41 | 2-108 | YNCDIIDNIEMKDGIVVYVIKQGNESEWFFSTRKGKFEVSEELGYKRTILVSIDYHRRVNDIKEIYQEIKEIGNMLRYVEYKGDIKI… |
| A0A0K0DIE9 | 58-163 | IISEQEMSQFVQLCSRRLDHEASIAIESRFECGPRYRFHIVDDIKTETIRNHFMFRENEWMFSSEKGRSALRNQTGKDRLAVVTLSR… |
| A0A821ICE4 | 3-122 | None |
| A0A3Q0FCY6 | 2-97 | None |
| A0A2U1QMC3 | 4-147 | None |
| A0A0N4W9Q2 | 729-863 | None |
| A0A835RUH1 | 1-136 | None |
| A0A453RL19 | 5-130 | None |
| A0A445EV83 | 327-444 | None |
| B7G3Q4 | 18-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.