DPCstruct | MC14103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 174 ± 13 aa |
| Standard deviation of domain lengths | 12.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.85 |
| Pfam Score | 88.99 |
| Assigned Pfam label(s) | PF12108- PF16837- PF13297 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5DAY5 | 3-186 | NVLEVQRRLHEERDRLIDTMTKEFLHERKSHKEKINGDHRLRRLVDRYHEVTKKLRLLYEDEDKSRKLELRAIASPNEFAEFYSRLK… |
| A0A094BBG4 | 2-185 | ILEEQRFLHEDLERLEQGIADRVADEPRHVRERLNRDHQVAGFLDRIQDQSKRLIDIYKDADSARSKEIQNISTGDPLAEFYKQLSD… |
| A0A200R0P5 | 1-147 | None |
| A0A024GM81 | 754-929 | None |
| A0A0B0MYU0 | 5-200 | None |
| A0A6M7YZE4 | 2-187 | None |
| T1KVI7 | 2-173 | None |
| A0A803QBT6 | 4-184 | None |
| A0A4T0HZK9 | 567-731 | None |
| S4R7J6 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.