DPCstruct | MC14102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 145 ± 7 aa |
| Standard deviation of domain lengths | 6.77 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 69.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A093ZCD9 | 1-154 | MAGGSVRFRTFPPHDHVRPEPRKPEHVPPPPASEGFTRSPKEDDVIVCPACDEELVVGAEEPATATPPGSTGKSATKAKARSRKDRE… |
| A0A0C4EAW9 | 334-467 | PHVRPDAEKPKYNAPKEAMEGCTRSTGEDVVAICPSCEEELVYDPDEKPTTPPPAKRQRTKKDRAEHHFMAVKACGHVFCHQCYETR… |
| A0A0J9WA79 | 136-283 | None |
| A0A2T4B6X7 | 262-408 | None |
| A0A4Q7JXU5 | 871-1022 | None |
| H0ED33 | 514-655 | None |
| A0A2P5HK29 | 739-889 | None |
| A0A4Q4V187 | 92-234 | None |
| T5A7V2 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.